Protein Info for Rv0549c in Mycobacterium tuberculosis H37Rv

Annotation: Possible toxin VapC3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF01850: PIN" amino acids 12 to 129 (118 residues), 54.1 bits, see alignment E=1.2e-18

Best Hits

Swiss-Prot: 99% identical to VAPC3_MYCTO: Ribonuclease VapC3 (vapC3) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 99% identity to mtf:TBFG_10560)

Predicted SEED Role

"Toxin 1, PIN domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>Rv0549c Possible toxin VapC3 (Mycobacterium tuberculosis H37Rv)
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQ
RAGALTVAYVDAALEELRQVPVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLL
TTDERLARAWPSAHAIG