Protein Info for Rv0548c in Mycobacterium tuberculosis H37Rv

Annotation: Naphthoate synthase MenB (dihydroxynaphthoic acid synthetase) (DHNA synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR01929: naphthoate synthase" amino acids 34 to 310 (277 residues), 443.8 bits, see alignment E=1.1e-137 PF00378: ECH_1" amino acids 48 to 308 (261 residues), 164 bits, see alignment E=4.3e-52 PF16113: ECH_2" amino acids 49 to 249 (201 residues), 53.4 bits, see alignment E=3e-18

Best Hits

Swiss-Prot: 100% identical to MENB_MYCTO: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01661, naphthoate synthase [EC: 4.1.3.36] (inferred from 100% identity to mbt:JTY_0562)

MetaCyc: 100% identical to naphthoate synthase monomer (Mycobacterium tuberculosis H37Rv)
Naphthoate synthase. [EC: 4.1.3.36]

Predicted SEED Role

"Naphthoate synthase (EC 4.1.3.36)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.1.3.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>Rv0548c Naphthoate synthase MenB (dihydroxynaphthoic acid synthetase) (DHNA synthetase) (Mycobacterium tuberculosis H37Rv)
VVAPAGEQGRSSTALSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNA
FRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASG
DTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYAR
FKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELE
TVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFL
QKRPPDWSPFPRYF