Protein Info for Rv0545c in Mycobacterium tuberculosis H37Rv

Annotation: Probable low-affinity inorganic phosphate transporter integral membrane protein PitA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 44 to 67 (24 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details PF01384: PHO4" amino acids 22 to 322 (301 residues), 281.9 bits, see alignment E=3.4e-88

Best Hits

Swiss-Prot: 100% identical to PIT_MYCTU: Probable low-affinity inorganic phosphate transporter (pit) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to mtc:MT0570)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>Rv0545c Probable low-affinity inorganic phosphate transporter integral membrane protein PitA (Mycobacterium tuberculosis H37Rv)
VNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVAVALPAVLNLIGAFLS
TAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSSSSHALIGGIVGATIAA
VGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRGVAEKRTERGFRRGQIGS
ASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVIVSCAVAMAAGTYLGGWRI
IRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQVATGSVLGSGVGKPGAEVR
WGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAILGFALLWLTATAIWLRSRRAP
IDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPTPPPNHRAPQFGVTTRNAP