Protein Info for Rv0533c in Mycobacterium tuberculosis H37Rv

Annotation: 3-oxoacyl-[acyl-carrier-protein] synthase III FabH (beta-ketoacyl-ACP synthase III) (KAS III)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 12 to 332 (321 residues), 447.3 bits, see alignment E=1.4e-138 PF00108: Thiolase_N" amino acids 46 to 154 (109 residues), 26.8 bits, see alignment E=4.9e-10 PF08545: ACP_syn_III" amino acids 116 to 193 (78 residues), 80.7 bits, see alignment E=9.2e-27 PF08541: ACP_syn_III_C" amino acids 242 to 332 (91 residues), 105.7 bits, see alignment E=1.7e-34

Best Hits

Swiss-Prot: 100% identical to FABH_MYCTU: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K11608, beta-ketoacyl ACP synthase [EC: 2.3.1.-] (inferred from 100% identity to mtc:MT0557)

MetaCyc: 100% identical to 3-oxoacyl-[acyl carrier protein] synthase III monomer (Mycobacterium tuberculosis H37Rv)
RXN1G-460 [EC: 2.3.1.301]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.301

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>Rv0533c 3-oxoacyl-[acyl-carrier-protein] synthase III FabH (beta-ketoacyl-ACP synthase III) (KAS III) (Mycobacterium tuberculosis H37Rv)
MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYTRTGIKTRRFAADDES
AASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMVAASLGAKGILGFDLSA
GCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDRGNCFIFADGAAAVVVGETP
FQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLEGPAVFRWAAFKMGDVGRR
AMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVANDIEHTGNTSAASIPLAMA
ELLTTGAAKPGDLALLIGYGAGLSYAAQVVRMPKG