Protein Info for Rv0519c in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details PF00756: Esterase" amino acids 88 to 297 (210 residues), 34.1 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtu:Rv0519c)

Predicted SEED Role

"Gamma-glutamyltranspeptidase (EC 2.3.2.2)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Utilization of glutathione as a sulphur source (EC 2.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.2.2

Use Curated BLAST to search for 2.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>Rv0519c Possible conserved membrane protein (Mycobacterium tuberculosis H37Rv)
VLRRGCAGNTDRRGIMTPMADLTRRALLRWGAGAGAGAAGVWAFGALVDPLEPQAAPAPF
EPPTAGSSLPTRISGSFISAARGGIKTNWVISMPPGQSGQLRPVIALHGKDGNAGMMLDL
GVEQGLARLVKEGKPAFAVVGVDGGNTYWHRRSSGGDSGAMVLDELLPMLTSMGMDTSRV
GFLGWSMGGYGALLLGARLGPARTAGICAISPALFTSFTGSTPGAFDSYDDYVQHSVLGL
PALNSIPLRVDCGTSDRFYFATRQFVNQLHQPPAGSFSPGGHDASYWREQLPGELAWMAS