Protein Info for Rv0509 in Mycobacterium tuberculosis H37Rv

Annotation: Probable glutamyl-tRNA reductase HemA (GLUTR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 187 to 194 (8 residues), see Phobius details TIGR01035: glutamyl-tRNA reductase" amino acids 3 to 427 (425 residues), 523.4 bits, see alignment E=2.2e-161 PF05201: GlutR_N" amino acids 7 to 156 (150 residues), 166.9 bits, see alignment E=4.1e-53 PF01488: Shikimate_DH" amino acids 172 to 314 (143 residues), 104.4 bits, see alignment E=8.2e-34 PF00745: GlutR_dimer" amino acids 328 to 426 (99 residues), 86.3 bits, see alignment E=2.4e-28

Best Hits

Swiss-Prot: 100% identical to HEM1_MYCBT: Glutamyl-tRNA reductase (hemA) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 100% identity to mra:MRA_0516)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>Rv0509 Probable glutamyl-tRNA reductase HemA (GLUTR) (Mycobacterium tuberculosis H37Rv)
VSVLLFGVSHRSAPVVVLEQLSIDESDQVKIIDRVLASPLVTEAMVLSTCNRVEVYAVVD
AFHGGLSVIGQVLAEHSGMSMGELTKYAYVRYSEAAVEHLFAVASGLDSAVIGEQQVLGQ
VRRAYAVAESNRTVGRVLHELAQRALSVGKRVHSETAIDAAGASVVSVALGMAERKLGSL
AGTTAVVIGAGAMGALSAVHLTRAGVGHIQVLNRSLSRAQRLARRIRESGVPAEALALDR
LANVLADADVVVSCTGAVRPVVSLADVHHALAAARRDEATRPLVICDLGMPRDVDPAVAR
LPCVWVVDVDSVQHEPSAHAAAADVEAARHIVAAEVASYLVGQRMAEVTPTVTALRQRAA
EVVEAELLRLDNRLPGLQSVQREEVARTVRRVVDKLLHAPTVRIKQLASAPGGDSYAEAL
RELFELDQTAVDAVATAGELPVVPSGFDAESRRGGGDMQSSPKRSPSN