Protein Info for Rv0503c in Mycobacterium tuberculosis H37Rv

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase 2 CmaA2 (cyclopropane fatty acid synthase) (CFA synthase) (cyclopropane mycolic acid synthase 2) (mycolic acid trans-cyclopropane synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF02353: CMAS" amino acids 13 to 298 (286 residues), 392.6 bits, see alignment E=2.4e-121 PF13489: Methyltransf_23" amino acids 66 to 195 (130 residues), 35.4 bits, see alignment E=2.2e-12 PF13649: Methyltransf_25" amino acids 77 to 159 (83 residues), 30.1 bits, see alignment E=1.6e-10 PF08242: Methyltransf_12" amino acids 77 to 177 (101 residues), 30.9 bits, see alignment E=9.4e-11 PF08241: Methyltransf_11" amino acids 77 to 177 (101 residues), 22.5 bits, see alignment E=3.7e-08

Best Hits

Swiss-Prot: 100% identical to CMAS2_MYCTO: Cyclopropane mycolic acid synthase 2 (cmaA2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to mbt:JTY_0516)

MetaCyc: 100% identical to cyclopropane mycolic acid synthase 2 (Mycobacterium tuberculosis H37Rv)
2.1.1.M101 [EC: 2.1.1.M101]; RXN1G-3667 [EC: 2.1.1.M101]

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase 2, CmaA2 (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79 or 2.1.1.M101

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>Rv0503c Cyclopropane-fatty-acyl-phospholipid synthase 2 CmaA2 (cyclopropane fatty acid synthase) (CFA synthase) (cyclopropane mycolic acid synthase 2) (mycolic acid trans-cyclopropane synthetase) (Mycobacterium tuberculosis H37Rv)
MTSQGDTTSGTQLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCAYFERPDMTLEEAQYAK
RKLALDKLNLEPGMTLLDIGCGWGSTMRHAVAEYDVNVIGLTLSENQYAHDKAMFDEVDS
PRRKEVRIQGWEEFDEPVDRIVSLGAFEHFADGAGDAGFERYDTFFKKFYNLTPDDGRML
LHTITIPDKEEAQELGLTSPMSLLRFIKFILTEIFPGGRLPRISQVDYYSSNAGWKVERY
HRIGANYVPTLNAWADALQAHKDEAIALKGQETYDIYMHYLRGCSDLFRDKYTDVCQFTL
VK