Protein Info for Rv0501 in Mycobacterium tuberculosis H37Rv

Annotation: Possible UDP-glucose 4-epimerase GalE2 (galactowaldenase) (UDP-galactose 4-epimerase) (uridine diphosphate galactose 4-epimerase) (uridine diphospho-galactose 4-epimerase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01370: Epimerase
  • amino acids 26 to 256 (231 residues), 79.9 bits, E=3e-26
• PF01073: 3Beta_HSD
  • amino acids 27 to 155 (129 residues), 37.5 bits, E=2.1e-13
• PF16363: GDP_Man_Dehyd
  • amino acids 27 to 160 (134 residues), 47.6 bits, E=2.6e-16

Best Hits

Swiss-Prot: 100% identical to Y501_MYCTU: Uncharacterized protein Rv0501 (Rv0501) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to mtb:TBMG_00508)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (33/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (18/18 steps found)
• colanic acid building blocks biosynthesis (11/11 steps found)
• D-galactose detoxification (3/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• D-galactose degradation I (Leloir pathway) (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• stachyose degradation (5/7 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Protein Sequence (376 amino acids)

>Rv0501 Possible UDP-glucose 4-epimerase GalE2 (galactowaldenase) (UDP-galactose 4-epimerase) (uridine diphosphate galactose 4-epimerase) (uridine diphospho-galactose 4-epimerase) (Mycobacterium tuberculosis H37Rv)
VSSSNGRGGAGGVGGSSEHPQYPKVVLVTGACRFLGGYLTARLAQNPLINRVIAVDAIAP
SKDMLRRMGRAEFVRADIRNPFIAKVIRNGEVDTVVHAAAASYAPRSGGSAALKELNVMG
AMQLFAACQKAPSVRRVVLKSTSEVYGSSPHDPVMFTEDSSSRRPFSQGFPKDSLDIEGY
VRALGRRRPDIAVTILRLANMIGPAMDTTLSRYLAGPLVPTIFGRDARLQLLHEQDALGA
LERAAMAGKAGTFNIGADGILMLSQAIRRAGRIPVPVPGFGVWALDSLRRANHYTELNRE
QFAYLSYGRVMDTTRMRVELGYQPKWTTVEAFDDYFRGRGLTPIIDPHRVRSWEGRAVGL
AQRWGSRNPIPWSGLR