Protein Info for Rv0494 in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein (probably GntR-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00392: GntR" amino acids 21 to 82 (62 residues), 65.1 bits, see alignment E=5.5e-22 PF13545: HTH_Crp_2" amino acids 44 to 89 (46 residues), 28.7 bits, see alignment 1.6e-10 PF07729: FCD" amino acids 108 to 228 (121 residues), 59.2 bits, see alignment E=8.4e-20

Best Hits

Swiss-Prot: 100% identical to Y494_MYCTO: Uncharacterized HTH-type transcriptional regulator MT0514 (MT0514) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_0536)

Predicted SEED Role

"Lactate-responsive regulator LldR in Enterobacteria, GntR family" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>Rv0494 Probable transcriptional regulatory protein (probably GntR-family) (Mycobacterium tuberculosis H37Rv)
LVEPMNQSSVFQPPDRQRVDERIATTIADAILDGVFPPGSTLPPERDLAERLGVNRTSLR
QGLARLQQMGLIEVRHGSGSVVRDPEGLTHPAVVEALVRKLGPDFLVELLEIRAALGPLI
GRLAAARSTPEDAEALCAALEVVQQADTAAARQAADLAYFRVLIHSTRNRALGLLYRWVE
HAFGGREHALTGAYDDADPVLTDLRAINGAVLAGDPAAAAATVEAYLNASALRMVKSYRD
RA