Protein Info for Rv0492c in Mycobacterium tuberculosis H37Rv

Annotation: Probable oxidoreductase GMC-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 629 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01494: FAD_binding_3" amino acids 147 to 216 (70 residues), 25.5 bits, see alignment E=2.8e-09 PF00890: FAD_binding_2" amino acids 148 to 179 (32 residues), 21.7 bits, see alignment (E = 3.8e-08) PF13450: NAD_binding_8" amino acids 151 to 180 (30 residues), 23.1 bits, see alignment (E = 2.5e-08) PF00732: GMC_oxred_N" amino acids 196 to 408 (213 residues), 211.8 bits, see alignment E=4.1e-66 PF05199: GMC_oxred_C" amino acids 496 to 615 (120 residues), 67.4 bits, see alignment E=7.3e-22

Best Hits

Swiss-Prot: 100% identical to Y492_MYCTU: Uncharacterized GMC-type oxidoreductase Rv0492c (Rv0492c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_0503)

Predicted SEED Role

"GMC oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (629 amino acids)

>Rv0492c Probable oxidoreductase GMC-type (Mycobacterium tuberculosis H37Rv)
MSRLADRAKSYPLASFGAALLPPELGGPLPAQFVQRVDRYVTRLPATSRFAVRAGLASLA
AASYLTTGRSLPRLHPDERARVLHRIAALSPEVAAAVEGLKAIVLLANGADTYAHELLAR
AQEHDAARPDAELTVILSADSPSVTRADAVVVGSGAGGAMVARTLARAGLDVVVLEEGRR
WTVEEFRSTHPVDRYAGLYRGAGATVALGRPAVVLPMGRAVGGTTVVNSGTCFRPSLAVQ
RRWRDEFGLGLADPDQLGRRLDDAEQTLRVAPVPLEIMGRNGRLLLQAAKSLGWRAAPIP
RNAPGCRGCCQCAIGCPSNAKFGVHLNALPQACAAGARIISWARVERILHRAGRAYGVRA
RRPDGTTLDVLADAVVVAAGATETPGLLRRSGLGGHPRLGHNLALHPATMLAGLFDDDVF
AWRGVLQSAAVHEFHESDGVLIEATSTPPGMGSMVFPGYGAELLRWLDRAPQIATFGAMV
ADRGVGTVRSVRGETVVRYDIAPGEIAKLRVALQAIGRLLFAAGAVEVLTGIPGAPPMRS
LPELQDVLRRANPRSLHLAAFHPTGTAAAGADEQLCPVDATGRLRGVEGVWVADASILPS
CPEVNPQLSIMAMALAVADQTVAKVVGVR