Protein Info for Rv0491 in Mycobacterium tuberculosis H37Rv

Annotation: Two component sensory transduction protein RegX3 (transcriptional regulatory protein) (probably LuxR-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 100.8 bits, see alignment E=5.1e-33 PF00486: Trans_reg_C" amino acids 150 to 225 (76 residues), 100.9 bits, see alignment E=3.2e-33

Best Hits

Swiss-Prot: 100% identical to REGX3_MYCBO: Sensory transduction protein regX3 (regX3) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K07776, two-component system, OmpR family, response regulator RegX3 (inferred from 99% identity to mmi:MMAR_0816)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR); Sensory transduction protein regX3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>Rv0491 Two component sensory transduction protein RegX3 (transcriptional regulatory protein) (probably LuxR-family) (Mycobacterium tuberculosis H37Rv)
MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSG
TDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGG
DDDSEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLID
RVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKLEG