Protein Info for Rv0490 in Mycobacterium tuberculosis H37Rv

Annotation: Putative two component sensor histidine kinase SenX3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00512: HisKA" amino acids 157 to 221 (65 residues), 55.9 bits, see alignment E=3.7e-19 PF02518: HATPase_c" amino acids 268 to 378 (111 residues), 100.5 bits, see alignment E=8e-33

Best Hits

Swiss-Prot: 100% identical to SENX3_MYCBO: Sensor-like histidine kinase senX3 (senX3) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K07768, two-component system, OmpR family, sensor histidine kinase SenX3 [EC: 2.7.13.3] (inferred from 100% identity to mbb:BCG_0531)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3); Sensor-like histidine kinase senX3 (EC 2.7.13.3)" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>Rv0490 Putative two component sensor histidine kinase SenX3 (Mycobacterium tuberculosis H37Rv)
VTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSGITVSQMLQCIVTLMP
LGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQALGGEDVEFDLSPRKRSATG
RSGLSVHGHARLLSEEDRRFAVVFVHDQSDYARMEAARRDFVANVSHELKTPVGAMALLA
EALLASADDSETVRRFAEKVLIEANRLGDMVAELIELSRLQGAERLPNMTDVDVDTIVSE
AISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLVSNAIAYSPRGSLVSISRRR
RGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVAANHDGTI
RVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRSNRSQREEELSR