Protein Info for Rv0488 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 24 to 51 (28 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details PF01810: LysE" amino acids 3 to 187 (185 residues), 167.2 bits, see alignment E=1.5e-53 TIGR00948: L-lysine exporter" amino acids 4 to 178 (175 residues), 232.9 bits, see alignment E=1e-73

Best Hits

Swiss-Prot: 100% identical to Y488_MYCTU: Putative amino-acid transporter Rv0488 (Rv0488) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 100% identity to mtu:Rv0488)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>Rv0488 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAALIHAHPNMTLV
ARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCLVVTFLNPHVYLDTVVL
IGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFATPAAWRILDALVAVTMIG
VAVVVLVTSPSVPTANVALII