Protein Info for Rv0486 in Mycobacterium tuberculosis H37Rv

Annotation: Glycosyltransferase MshA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03449: D-inositol-3-phosphate glycosyltransferase
  • amino acids 46 to 445 (400 residues), 671.9 bits, E=1.5e-206
• PF13439: Glyco_transf_4
  • amino acids 66 to 245 (180 residues), 95.4 bits, E=1e-30
• PF13579: Glyco_trans_4_4
  • amino acids 66 to 241 (176 residues), 107.2 bits, E=2.8e-34
• PF20706: GT4-conflict
  • amino acids 136 to 437 (302 residues), 60.2 bits, E=4.5e-20
• PF00534: Glycos_transf_1
  • amino acids 252 to 407 (156 residues), 126.3 bits, E=2.4e-40
• PF13692: Glyco_trans_1_4
  • amino acids 266 to 406 (141 residues), 86.2 bits, E=6.7e-28

Best Hits

Swiss-Prot: 100% identical to MSHA_MYCTU: D-inositol 3-phosphate glycosyltransferase (mshA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv0486)

Predicted SEED Role

"Glycosyltransferase MshA involved in mycothiol biosynthesis (EC 2.4.1.-)" in subsystem Glutathione analogs: mycothiol (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (480 amino acids)

>Rv0486 Glycosyltransferase MshA (Mycobacterium tuberculosis H37Rv)
MAGVRHDDGSGLIAQRRPVRGEGATRSRGPSGPSNRNVSAADDPRRVALLAVHTSPLAQP
GTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPVVRVAPGVLVRNVVAGPFEGL
DKYDLPTQLCAFAAGVLRAEAVHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTL
AAVKNAALADGDGPEPPLRTVGEQQVVDEADRLIVNTDDEARQVISLHGADPARIDVVHP
GVDLDVFRPGDRRAARAALGLPVDERVVAFVGRIQPLKAPDIVLRAAAKLPGVRIIVAGG
PSGSGLASPDGLVRLADELGISARVTFLPPQSHTDLATLFRAADLVAVPSYSESFGLVAV
EAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWADAIDHLLRLCAGPRGRVMSRA
AARHAATFSWENTTDALLASYRRAIGEYNAERQRRGGEVISDLVAVGKPRHWTPRRGVGA