Protein Info for Rv0484c in Mycobacterium tuberculosis H37Rv

Annotation: Probable short-chain type oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00106: adh_short" amino acids 9 to 186 (178 residues), 153.7 bits, see alignment E=1.1e-48 PF01370: Epimerase" amino acids 12 to 120 (109 residues), 33.6 bits, see alignment E=7e-12 PF08659: KR" amino acids 12 to 164 (153 residues), 37.2 bits, see alignment E=7.1e-13 PF13460: NAD_binding_10" amino acids 15 to 139 (125 residues), 35.4 bits, see alignment E=2.6e-12 PF13561: adh_short_C2" amino acids 15 to 220 (206 residues), 113.9 bits, see alignment E=2.3e-36

Best Hits

Swiss-Prot: 100% identical to Y484_MYCTU: Uncharacterized oxidoreductase Rv0484c (Rv0484c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_0495)

MetaCyc: 45% identical to sulfoacetaldehyde reductase monomer (Chromohalobacter salexigens DSM 3043)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

"FIG01310822: Short chain dehydrogenase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.313

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>Rv0484c Probable short-chain type oxidoreductase (Mycobacterium tuberculosis H37Rv)
MTTIGTRKRVAVVTGASSGIGEATARTLAAQGFHVVAVARRADRITALANQIGGTAIVAD
VTDDAAVEALARALSRVDVLVNNAGGAKGLQFVADADLEHWRWMWDTNVLGTLRVTRALL
PKLIDSGDGLIVTVTSIAAIEVYDGGAGYTAAKHAQGALHRTLRGELLGKPVRLTEIAPG
AVETEFSLVRFDGDQQRADAVYAGMTPLVAADVAEVIGFVATRPSHVNLDQIVIRPRDQA
SASRRATHPVR