Protein Info for Rv0478 in Mycobacterium tuberculosis H37Rv

Annotation: Probable deoxyribose-phosphate aldolase DeoC (phosphodeoxyriboaldolase) (deoxyriboaldolase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00126: deoxyribose-phosphate aldolase
  • amino acids 9 to 216 (208 residues), 206.4 bits, E=1.8e-65
• PF01791: DeoC
  • amino acids 12 to 218 (207 residues), 65.5 bits, E=2.9e-22

Best Hits

Swiss-Prot: 100% identical to DEOC_MYCTA: Deoxyribose-phosphate aldolase (deoC) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 100% identity to mbt:JTY_0489)

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

• superpathway of purine deoxyribonucleosides degradation (6/7 steps found)
• 2-deoxy-D-ribose degradation I (3/3 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (5/6 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (2/3 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.4

Protein Sequence (224 amino acids)

>Rv0478 Probable deoxyribose-phosphate aldolase DeoC (phosphodeoxyriboaldolase) (deoxyriboaldolase) (Mycobacterium tuberculosis H37Rv)
VLGQPTRAQLAALVDHTLLKPETTRADVAALVAEAAELGVYAVCVSPSMVPVAVQAGGVR
VAAVTGFPSGKHVSSVKAHEAAAALASGASEIDMVIDIGAALCGDIDAVRSDIEAVRAAA
AGAVLKVIVESAVLLGQSNAHTLVDACRAAEDAGADFVKTSTGCHPAGGATVRAVELMAE
TVGPRLGVKASGGIRTAADAVAMLNAGATRLGLSGTRAVLDGLS