Protein Info for Rv0465c in Mycobacterium tuberculosis H37Rv

Annotation: Probable transcriptional regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 PF12844: HTH_19" amino acids 7 to 62 (56 residues), 40.8 bits, see alignment 4.8e-14 PF13560: HTH_31" amino acids 7 to 61 (55 residues), 41.8 bits, see alignment 2.7e-14 PF01381: HTH_3" amino acids 10 to 63 (54 residues), 48.7 bits, see alignment 1.6e-16 PF06114: Peptidase_M78" amino acids 188 to 310 (123 residues), 93 bits, see alignment E=3e-30 PF09856: ScfRs" amino acids 311 to 469 (159 residues), 234.8 bits, see alignment E=1.1e-73

Best Hits

Swiss-Prot: 100% identical to RAMB_MYCTO: HTH-type transcriptional regulator RamB (ramB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K07110, (no description) (inferred from 100% identity to mtb:TBMG_00467)

Predicted SEED Role

"Transcriptional regulator, XRE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>Rv0465c Probable transcriptional regulatory protein (Mycobacterium tuberculosis H37Rv)
VSKTYVGSRVRQLRNERGFSQAALAQMLEISPSYLNQIEHDVRPLTVAVLLRITEVFGVD
ATFFASQDDTRLVAELREVTLDRDLDIAIDPHEVAEMVSAHPGLACAVVNLHRRYRITTA
QLAAATEERFSDGSGRGSITMPHEEVRDYFYQRQNYLHALDTAAEDLTAQMRMHHGDLAR
ELTRRLTEVHGVRINKRIDLGDTVLHRYDPATNTLEISSHLSPGQQVFKMAAELAYLEFG
DLIDAMVTDGKFTSAESRTLARLGLANYFAAATVLPYRQFHDVAENFRYDVERLSAFYSV
SYETIAHRLSTLQRPSMRGVPFTFVRVDRAGNMSKRQSATGFHFSSSGGTCPLWNVYETF
ANPGKILVQIAQMPDGRNYLWVARTVELRAARYGQPGKTFAIGLGCELRHAHRLVYSEGL
DLSGDPNTAATPIGAGCRVCERDNCPQRAFPALGRALDLDEHRSTVSPYLVKQL