Protein Info for Rv0432 in Mycobacterium tuberculosis H37Rv

Annotation: Periplasmic superoxide dismutase [Cu-Zn] SodC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00080: Sod_Cu
  • amino acids 86 to 237 (152 residues), 87.2 bits, E=6.9e-29

Best Hits

Swiss-Prot: 100% identical to SODC_MYCBO: Superoxide dismutase [Cu-Zn] (sodC) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K04565, Cu/Zn superoxide dismutase [EC: 1.15.1.1] (inferred from 100% identity to mtb:TBMG_00433)

Predicted SEED Role

"Superoxide dismutase [Cu-Zn] precursor (EC 1.15.1.1)" in subsystem Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• superoxide radicals degradation (2/2 steps found)
• reactive oxygen species degradation (3/4 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Protein Sequence (240 amino acids)

>Rv0432 Periplasmic superoxide dismutase [Cu-Zn] SodC (Mycobacterium tuberculosis H37Rv)
MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIWTGSPAPSGLS
GHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTGVGKLTPGFHGLHIHQV
GKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQVRGDGSAMLVTTTDAFT
MDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG