Protein Info for Rv0429c in Mycobacterium tuberculosis H37Rv

Annotation: Probable polypeptide deformylase Def (PDF) (formylmethionine deformylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF01327: Pep_deformylase" amino acids 5 to 163 (159 residues), 132.2 bits, see alignment E=6.3e-43 TIGR00079: peptide deformylase" amino acids 28 to 167 (140 residues), 106.4 bits, see alignment E=5.5e-35

Best Hits

Swiss-Prot: 100% identical to DEF_MYCBP: Peptide deformylase (def) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K01462, peptide deformylase [EC: 3.5.1.88] (inferred from 100% identity to mbo:Mb0437c)

Predicted SEED Role

"Peptide deformylase (EC 3.5.1.88)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase (EC 3.5.1.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>Rv0429c Probable polypeptide deformylase Def (PDF) (formylmethionine deformylase) (Mycobacterium tuberculosis H37Rv)
MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMDAANGVGLAANQIGCS
LRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDTDDEGCLSVPGESFPTGRAK
WARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLIGRYARNAKRAVKSHGWG
VPGLSWLPGEDPDPFGH