Protein Info for Rv0428c in Mycobacterium tuberculosis H37Rv

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF24551: SH3_Rv0428c" amino acids 6 to 60 (55 residues), 77.5 bits, see alignment E=6.6e-26 PF24553: Rv0428c_C" amino acids 69 to 292 (224 residues), 323.9 bits, see alignment E=5.6e-101

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_0437)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>Rv0428c GCN5-related N-acetyltransferase (Mycobacterium tuberculosis H37Rv)
MVSWPGLGTRVTVRYRRPAGSMPPLTDAVGRLLAVDPTVRVQTKTGTIVEFSPVDVVALR
VLTDAPVRTAAIRALEHAAAAAWPGVERTWLDGWLLRAGHGAVLAANSAVPLDISAHTNT
ITEISAWYASRDLQPWLAVPDRLLPLPADLAGERREQVLVRDVSTGEPDRSVTLLDHPDD
TWLRLYHQRLPLDMATPVIDGELAFGSYLGVAVARAAVTDAPDGTRWVGLSAMRAADEQS
ATGSAGRQLWEALLGWGAGRGATRGYVRVHDTATSVLAESLGFRLHHHCRYLPAQSVGWD
TF