Protein Info for Rv0422c in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphomethylpyrimidine kinase ThiD (HMP-phosphate kinase) (HMP-P kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
  • amino acids 6 to 259 (254 residues), 279.9 bits, E=8.2e-88
• PF08543: Phos_pyr_kin
  • amino acids 13 to 258 (246 residues), 287.5 bits, E=8.2e-90
• PF00294: PfkB
  • amino acids 116 to 238 (123 residues), 43.4 bits, E=3e-15

Best Hits

Swiss-Prot: 100% identical to THID_MYCTO: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 100% identity to mra:MRA_0428)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis I (2/2 steps found)
• hydroxymethylpyrimidine salvage (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (3/7 steps found)
• thiamine diphosphate salvage IV (yeast) (3/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (3/8 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (2/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Protein Sequence (265 amino acids)

>Rv0422c Probable phosphomethylpyrimidine kinase ThiD (HMP-phosphate kinase) (HMP-P kinase) (Mycobacterium tuberculosis H37Rv)
MTPPRVLSIAGSDSGGGAGIQADMRTMALLGVHACVAVTAVTVQNTLGVKDIHEVPNDVV
AGQIEAVVTDIGVQAAKTGMLASSRIVATVAATWRRLELSVPLVVDPVCASMHGDPLLAP
SALDSLRGQLFPLATLLTPNLDEARLLVDIEVVDAESQRAAAKALHALGPQWVLVKGGHL
RSSDGSCDLLYDGVSCYQFDAQRLPTGDDHGGGDTLATAIAAALAHGFTVPDAVDFGKRW
VTECLRAAYPLGRGHGPVSPLFRLS