Protein Info for Rv0413 in Mycobacterium tuberculosis H37Rv

Annotation: Possible mutator protein MutT3 (7,8-dihydro-8-oxoguanine-triphosphatase) (8-oxo-dGTPase) (dGTP pyrophosphohydrolase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF00293: NUDIX" amino acids 45 to 155 (111 residues), 64.1 bits, see alignment E=6.9e-22

Best Hits

Swiss-Prot: 100% identical to MUTT3_MYCTU: Putative 8-oxo-dGTP diphosphatase 3 (mutT3) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03574, 7,8-dihydro-8-oxoguanine triphosphatase [EC: 3.6.1.-] (inferred from 100% identity to mbb:BCG_0452)

Predicted SEED Role

"Possible mutator protein MutT3 (7,8-dihydro-8-oxoguanine-triphosphatase)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>Rv0413 Possible mutator protein MutT3 (7,8-dihydro-8-oxoguanine-triphosphatase) (8-oxo-dGTPase) (dGTP pyrophosphohydrolase) (Mycobacterium tuberculosis H37Rv)
LPSCPPAYSEQVRGDGDGWVVSDSGVAYWGRYGAAGLLLRAPRPDGTPAVLLQHRALWSH
QGGTWGLPGGARDSHETPEQTAVRESSEEAGLSAERLEVRATVVTAEVCGVDDTHWTYTT
VVADAGELLDTVPNRESAELRWVAENEVADLPLHPGFAASWQRLRTAPATVPLARCDERR
QRLPRTIQIEAGVFLWCTPGDADQAPSPLGRRISSLL