Protein Info for Rv0403c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved membrane protein MmpS1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details amino acids 28 to 28 (1 residues), see Phobius details transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details PF05423: Mycobact_memb" amino acids 6 to 142 (137 residues), 222.4 bits, see alignment E=9.7e-71

Best Hits

Swiss-Prot: 100% identical to MMPS1_MYCTU: Probable transport accessory protein MmpS1 (mmpS1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00404)

Predicted SEED Role

"membrane protein, MmpS family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>Rv0403c Probable conserved membrane protein MmpS1 (Mycobacterium tuberculosis H37Rv)
MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLDPIIAFYPKHVLYEVF
GPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVVARGDGASLGCRITVNE
VIREERIVNAYHAHTSCLVKSA