Protein Info for Rv0389 in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphoribosylglycinamide formyltransferase 2 PurT (GART 2) (gar transformylase 2) (5'-phosphoribosylglycinamide transformylase 2) (formate-dependent gar transformylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 TIGR01142: phosphoribosylglycinamide formyltransferase 2" amino acids 27 to 414 (388 residues), 523.1 bits, see alignment E=1.9e-161 PF02222: ATP-grasp" amino acids 137 to 325 (189 residues), 83.8 bits, see alignment E=6.3e-28

Best Hits

KEGG orthology group: K08289, phosphoribosylglycinamide formyltransferase 2 [EC: 2.1.2.2] (inferred from 100% identity to mtf:TBFG_10393)

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase 2 (EC 2.1.2.-)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.- or 2.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (419 amino acids)

>Rv0389 Probable phosphoribosylglycinamide formyltransferase 2 PurT (GART 2) (gar transformylase 2) (5'-phosphoribosylglycinamide transformylase 2) (formate-dependent gar transformylase) (Mycobacterium tuberculosis H37Rv)
VIDGWTEEQHEPTVRHERPAAPQDVRRVMLLGSAEPSRELAIALQGLGAEVIAVDGYVGA
PAHRIADQSVVVTMTDAEELTAVIRRLQPDFLVTVTAAVSVDALDAVEQADGECTELVPN
ARAVRCTADREGLRRLAADQLGLPTAPFWFVGSLGELQAVAVHAGFPLLVSPVAGVAGQG
SSVVAGPNEVEPAWQRAAGHQVQPQTGGVSPRVCAESVVEIEFLVTMIVVCSQGPNGPLI
EFCAPIGHRDADAGELESWQPQKLSTAALDAAKSIAARIVKALGGRGVFGVELMINGDEV
YFADVTVCPAGSAWVTVRSQRLSVFELQARAILGLAVDTLMISPGAARVINPDHTAGRAA
VGAAPPADALTGALGVPESDVVIFGRGLGVALATAPEVAIARERAREVASRLNVPDSRE