Protein Info for Rv0362 in Mycobacterium tuberculosis H37Rv

Annotation: Possible Mg2+ transport transmembrane protein MgtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 292 to 312 (21 residues), see Phobius details amino acids 318 to 345 (28 residues), see Phobius details amino acids 366 to 386 (21 residues), see Phobius details amino acids 394 to 415 (22 residues), see Phobius details amino acids 427 to 451 (25 residues), see Phobius details PF03448: MgtE_N" amino acids 37 to 134 (98 residues), 66 bits, see alignment E=6e-22 TIGR00400: magnesium transporter" amino acids 38 to 454 (417 residues), 294 bits, see alignment E=9.3e-92 PF00571: CBS" amino acids 204 to 256 (53 residues), 28.4 bits, see alignment 2.5e-10 PF01769: MgtE" amino acids 326 to 449 (124 residues), 106.5 bits, see alignment E=1.7e-34

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to mbo:Mb0369)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>Rv0362 Possible Mg2+ transport transmembrane protein MgtE (Mycobacterium tuberculosis H37Rv)
VSIRPAENSTLDIRHVIGIGTPKAVDLWLDVVTELPDRARELGSLSKAELGKLGPLLDGT
NAVELFESIDDKLAAEALHAMDPSLAATFLEALDSDHAANILREFKEPKREALLTLLPLE
RAMVLRGLLSWPEDCAAAHMVPETLTVRPNMTVSQAVASVRERASGLRSDARTTAYVYVT
DADSHLLGVIAFRALVLANPEQRVRELMGDDLIVVSPLTDKELAAQTIMGHNLMAVPVVD
ADNRLLGIIAEDEAIDIAEEEATEDAERQGGSAPLEVPYLRASPWLLWRKRVVWLLVLFA
AEAYTGSVLRAFSDEMEAVIALAFFIPLLIGTGGNTGTQIATTLVRAMATGQVRFRDVPA
VLAKELSTGVLVGLTMAAAAVVRAWTLGVGPQVTLTVALTVAAIVVWSSLVAAVLPPLLK
KLRIDPAIVSGPMIATIVDGTGLLIYFLVAHLTLTELHGL