Protein Info for Rv0359 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 94 to 117 (24 residues), see Phobius details amino acids 129 to 153 (25 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 209 to 235 (27 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to RIP2_MYCTU: Putative zinc metalloprotease Rip2 (rip2) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_0367)

Predicted SEED Role

"Sterol-regulatory element binding protein (SREBP) site 2 protease family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (259 amino acids)

>Rv0359 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
VSETGQRESVRPSPIFLGLLGLTAVGGALAWLAGETVQPLAYAGVFVMVIAGWLVSLCLH
EFGHAFTAWRFGDHDVAVRGYLTLDPRRYSHPMLSLGLPMLFIALGGIGLPGAAVYVHTW
FMTTARRTLVSLAGPTVNLALAMLLLAATRLLFDPIHAVLWAGVAFLAFLQLTALVLNLL
PIPGLDGYAALEPHLRPETQRALAPAKQFALVFLLVLFLAPTLNGWFFGVVYWLFDLSGV
SHRLAAAGSVLARFWSIWF