Protein Info for Rv0337c in Mycobacterium tuberculosis H37Rv

Annotation: Probable aspartate aminotransferase AspC (transaminase A) (ASPAT)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF00155: Aminotran_1_2" amino acids 59 to 406 (348 residues), 166.5 bits, see alignment E=1e-52 PF01041: DegT_DnrJ_EryC1" amino acids 134 to 232 (99 residues), 21.5 bits, see alignment E=1.3e-08

Best Hits

Swiss-Prot: 100% identical to AAT_MYCTO: Probable aspartate aminotransferase (aspC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K14260, alanine-synthesizing transaminase [EC: 2.6.1.2 2.6.1.66] (inferred from 100% identity to mtf:TBFG_10342)

MetaCyc: 59% identical to glutamate--pyruvate aminotransferase AlaA (Escherichia coli K-12 substr. MG1655)
Alanine transaminase. [EC: 2.6.1.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.2 or 2.6.1.66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>Rv0337c Probable aspartate aminotransferase AspC (transaminase A) (ASPAT) (Mycobacterium tuberculosis H37Rv)
VDNDGTIVDVTTHQLPWHTASHQRQRAFAQSAKLQDVLYEIRGPVHQHAARLEAEGHRIL
KLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSQGILSARRAVVTRYELVPGFPRFDV
DDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGWQ
PDIADLESKITERTKALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILY
DDAKHISLASIAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKEHASSFIEGIGLLANMR
LCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDIAWTKLNEIPGVSCVKPAGALYAF
PRLDPEVYDIDDDEQLVLDLLLSEKILVTQGTGFNWPAPDHLRLVTLPWSRDLAAAIERL
GNFLVSYRQ