Protein Info for Rv0328 in Mycobacterium tuberculosis H37Rv

Annotation: Possible transcriptional regulatory protein (possibly TetR/AcrR-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 156 to 172 (17 residues), see Phobius details PF00440: TetR_N" amino acids 11 to 55 (45 residues), 58.9 bits, see alignment 5.1e-20 PF13977: TetR_C_6" amino acids 82 to 180 (99 residues), 39.5 bits, see alignment E=8.8e-14 PF17940: TetR_C_31" amino acids 84 to 188 (105 residues), 29.5 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb0335)

Predicted SEED Role

"HTH-type transcriptional regulator BetI" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>Rv0328 Possible transcriptional regulatory protein (possibly TetR/AcrR-family) (Mycobacterium tuberculosis H37Rv)
VQQQRTNRDKLLDGALACLRERGYGNTSSRDIARAAGVNIASINYHFGSKDALLDDALGR
CFSTWNQRVQEAFDHSRAAGPAGQILAVLEATVDSFEQIRPAVYACVESYAPALRSEALR
ERLAAGYADVRQHSVDLAGAALAGTDIAPPENLSTIVSVLMAVIDGLMIQWIADPSATPR
STEVIRALASIGAVVTSQLR