Protein Info for Rv0322 in Mycobacterium tuberculosis H37Rv

Annotation: Probable UDP-glucose 6-dehydrogenase UdgA (UDP-GLC dehydrogenase) (UDP-GLCDH) (UDPGDH)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 307 to 327 (21 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 2 to 419 (418 residues), 436.4 bits, see alignment E=4.8e-135 PF03721: UDPG_MGDP_dh_N" amino acids 2 to 181 (180 residues), 207.4 bits, see alignment E=3e-65 PF00984: UDPG_MGDP_dh" amino acids 204 to 297 (94 residues), 107.4 bits, see alignment E=6.6e-35 PF03720: UDPG_MGDP_dh_C" amino acids 322 to 422 (101 residues), 102.3 bits, see alignment E=3.4e-33

Best Hits

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 100% identity to mbb:BCG_0362)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>Rv0322 Probable UDP-glucose 6-dehydrogenase UdgA (UDP-GLC dehydrogenase) (UDP-GLCDH) (UDPGDH) (Mycobacterium tuberculosis H37Rv)
VRCSVFGTGYLGATHAVGMAQLGHEVVGVDIDPGKVAKLAGGDIPFYEPGLRKLLTDNLA
AGRLRFTTDYDMAADFADVHFLGVGTPQKIGEYGADLRHVHAVIDALVPRLVRASILVGK
STVPVGTAAELGHRAGALAPRGVDVEIAWNPEFLREGFAVHDTLNPDRIVLGVQDDSTRA
EVAVRELYAPLLAAGVPFLVTDLQTAELVKVSANAFLATKISFINAISEVCEAAGADVSQ
LADALGYDPRIGRQCLNAGLGFGGGCLPKDIRAFMARAGELGADQALTFLREVDSINMRR
RTKMVELATTACGGSLLGANIAVLGAAFKPESDDVRDSPALNVAGQLQLNGATVHVYDPK
ALDNAHRLFPTLNYAVSVAEACERADAVLVLTEWREFIDLEPADLANRVRARVIVDGRNC
LDVTRWRRAGWRVFRLGVPRLGH