Protein Info for Rv0321 in Mycobacterium tuberculosis H37Rv

Annotation: Probable deoxycytidine triphosphate deaminase Dcd (dCTP deaminase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 3 to 181 (179 residues), 213.9 bits, E=7e-68
• PF06559: DCD
  • amino acids 67 to 175 (109 residues), 31.5 bits, E=8.3e-12
• PF00692: dUTPase
  • amino acids 70 to 177 (108 residues), 40.5 bits, E=2.2e-14

Best Hits

Swiss-Prot: 100% identical to DCDB_MYCTA: dCTP deaminase, dUMP-forming (dcd) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 99% identity to mbt:JTY_0331)

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.30) (dUMP-forming)" (EC 3.5.4.30)

MetaCyc Pathways

• pyrimidine deoxyribonucleotides de novo biosynthesis IV (7/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13 or 3.5.4.30

Protein Sequence (190 amino acids)

>Rv0321 Probable deoxycytidine triphosphate deaminase Dcd (dCTP deaminase) (Mycobacterium tuberculosis H37Rv)
VLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNNTRYTHIDPAKQQDEL
TSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAGFIDP
GFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYGSSRAGSKYQGQRGPTPS
RSYQNFIRST