Protein Info for Rv0319 in Mycobacterium tuberculosis H37Rv

Annotation: Probable pyrrolidone-carboxylate peptidase Pcp (5-oxoprolyl-peptidase) (pyroglutamyl-peptidase I) (PGP-I) (pyrase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR00504: pyroglutamyl-peptidase I" amino acids 3 to 220 (218 residues), 339.7 bits, see alignment E=4.1e-106 PF01470: Peptidase_C15" amino acids 3 to 208 (206 residues), 318.8 bits, see alignment E=9.8e-100

Best Hits

Swiss-Prot: 100% identical to PCP_MYCBO: Pyrrolidone-carboxylate peptidase (pcp) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K01304, pyroglutamyl-peptidase [EC: 3.4.19.3] (inferred from 100% identity to mtb:TBMG_00323)

Predicted SEED Role

"Pyrrolidone-carboxylate peptidase (EC 3.4.19.3)" in subsystem ZZ gjo need homes (EC 3.4.19.3)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>Rv0319 Probable pyrrolidone-carboxylate peptidase Pcp (5-oxoprolyl-peptidase) (pyroglutamyl-peptidase I) (PGP-I) (pyrase) (Mycobacterium tuberculosis H37Rv)
MSKVLVTGFGPYGVTPVNPAQLTAEELDGRTIAGATVISRIVPNTFFESIAAAQQAIAEI
EPALVIMLGEYPGRSMITVERLAQNVNDCGRYGLADCAGRVLVGEPTDPAGPVAYHATVP
VRAMVLAMRKAGVPADVSDAAGTFVCNHLMYGVLHHLAQKGLPVRAGWIHLPCLPSVAAL
DHNLGVPSMSVQTAVAGVTAGIEAAIRQSADIREPIPSRLQI