Protein Info for Rv0318c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 22 to 47 (26 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details PF02535: Zip" amino acids 131 to 263 (133 residues), 47.4 bits, see alignment E=8.5e-17

Best Hits

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 99% identity to mbt:JTY_0328)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>Rv0318c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
LSLAVTMFKRARAEIFDRNREVGISNVTTAASLVTFPVLAGILGGVVPSVRTPSAAMVSG
VQHFAAGIVMAAVAGEVLPDLRSRGPLWLIVVGFSAGVAVLVALRRFDGHGEHQDGDDVG
ELPVGFLTVVAVDLFIDGLLVATGATVSSRTAIIITIALTVEVLFLGLAVALRLAGSGMP
RIRAAATTSALSLVIAVGGVSGAVALGRAGNTVLTLVLAFAAGALLWLVVEELLVEAHET
PERPWMAVMFFAGFLILYGLGVME