Protein Info for Rv0305c in Mycobacterium tuberculosis H37Rv

Annotation: PPE family protein PPE6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 963 PF00823: PPE" amino acids 2 to 165 (164 residues), 204.4 bits, see alignment E=1.2e-64 PF01469: Pentapeptide_2" amino acids 199 to 237 (39 residues), 29.3 bits, see alignment (E = 6.6e-11) amino acids 219 to 257 (39 residues), 36.9 bits, see alignment (E = 2.7e-13) amino acids 282 to 318 (37 residues), 36.2 bits, see alignment (E = 4.6e-13) amino acids 320 to 359 (40 residues), 39.3 bits, see alignment (E = 4.9e-14) amino acids 361 to 399 (39 residues), 38.7 bits, see alignment (E = 7.6e-14) amino acids 643 to 681 (39 residues), 31.1 bits, see alignment (E = 1.7e-11) amino acids 659 to 697 (39 residues), 34.4 bits, see alignment (E = 1.6e-12) amino acids 702 to 738 (37 residues), 38.4 bits, see alignment (E = 9.4e-14) amino acids 730 to 768 (39 residues), 31.1 bits, see alignment (E = 1.8e-11) amino acids 740 to 779 (40 residues), 35.3 bits, see alignment (E = 8.6e-13) amino acids 771 to 808 (38 residues), 43.3 bits, see alignment (E = 2.8e-15)

Best Hits

KEGG orthology group: None (inferred from 87% identity to mtu:Rv0305c)

Predicted SEED Role

"PPE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (963 amino acids)

>Rv0305c PPE family protein PPE6 (Mycobacterium tuberculosis H37Rv)
MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWFGSVTSGLADAAWRGP
AAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAATVHPAIVAANRAVLVSL
VSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVSALMPFTQQLKKLAGLSE
RLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGFGNLGSYNLGFANLGSDNL
GLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIGFGSFNSGSHNIGLFNSGSG
NVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDVNTGGFNPGSYNTGNFNTGNY
NTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGNYSNGVLWRGDYQGLIGADIAL
EIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTSIVPFVVYYGPVELPQSTLTLPT
VTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFGNSTTSPSSGFFNAGAGTASGFGN
FGGGASGFWNLASATSGLSGFGNVGALGSGVANVGNTISGLYNTSTSNLATPAFNSGLLH
HSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANLGDYNIGFGNLGGDNLGFAHAGSYNI
GFANTGSNNLGFANTGDNNIGFANIGSNNIGIGLTGSGQIGFGSLNSGSHNIGLFNSGDG
NIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFGIGNAGSTNTGLFNSGDLNTGSLNPGSY
NTGSVNTGSVNTGGFNAGNYNTGYFNTGDLQHRHGEHRQYQHRRFHLRQPQQRPSVAGRQ
PGSDRPRHRRRHSRNPDCERRREYPDSHTDHRQLHGHRIQRARSSTEHSRHCYFFRTRRY
RPLHRPSDTDNRSHTCGHGGWTHYRDQYRRHCGRRRHQHPDYPYSSDSRLRQLDRRTVVG
LLQ