Protein Info for Rv0295c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to STF0_MYCTE: Trehalose 2-sulfotransferase (stf0) from Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman)

KEGG orthology group: None (inferred from 100% identity to mbb:BCG_0335c)

MetaCyc: 100% identical to trehalose 2-sulfotransferase (Mycobacterium tuberculosis H37Rv)
RXN-15426 [EC: 2.8.2.37]

Predicted SEED Role

"Sulfotransferase"

MetaCyc Pathways

mycobacterial sulfolipid biosynthesis (5/9 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.2.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>Rv0295c Conserved protein (Mycobacterium tuberculosis H37Rv)
MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTGMAPQPREWFAGVDDD
TILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWNQTALLQQRAAQLPDRS
GDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWRGHPDPKRDSQAVYHAGA
IAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIVASVLDAIGQDPKLAPAPM
LERQANQRSDEWVDRYRAEAPRLGLPT