Protein Info for Rv0281 in Mycobacterium tuberculosis H37Rv

Annotation: Possible S-adenosylmethionine-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR00027: methyltransferase, TIGR00027 family" amino acids 16 to 279 (264 residues), 280.6 bits, see alignment E=5.9e-88 PF04072: LCM" amino acids 18 to 198 (181 residues), 221 bits, see alignment E=6.4e-70

Best Hits

Swiss-Prot: 100% identical to Y293_MYCTU: Putative S-adenosyl-L-methionine-dependent methyltransferase Rv0281 (Rv0281) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_0290)

Predicted SEED Role

"O-Methyltransferase involved in polyketide biosynthesis"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>Rv0281 Possible S-adenosylmethionine-dependent methyltransferase (Mycobacterium tuberculosis H37Rv)
VRTEGDSWDITTSVGSTALFVATARALEAQKSDPLVVDPYAEAFCRAVGGSWADVLDGKL
PDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAAAGARQVVILAAGLDSRAYRLPWPDGT
TVFELDRPQVLDFKREVLASHGAQPRALRREIAVDLRDDWPQALRDSGFDAAAPSAWIAE
GLLIYLPATAQERLFTGIDALAGRRSHVAVEDGAPMGPDEYAAKVEEERAAIAEGAEEHP
FFQLVYNERCAPAAEWFGERGWTAVATLLNDYLEAVGRPVPGPESEAGPMFARNTLVSAA
RV