Protein Info for Rv0280 in Mycobacterium tuberculosis H37Rv

Annotation: PPE family protein PPE3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 transmembrane" amino acids 295 to 315 (21 residues), see Phobius details PF00823: PPE" amino acids 4 to 166 (163 residues), 205 bits, see alignment E=8e-65 PF18878: PPE-PPW" amino acids 473 to 520 (48 residues), 72.2 bits, see alignment 2.9e-24

Best Hits

Swiss-Prot: 100% identical to PPE03_MYCTU: Uncharacterized PPE family protein PPE3 (PPE3) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_0290)

Predicted SEED Role

"PPE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>Rv0280 PPE family protein PPE3 (Mycobacterium tuberculosis H37Rv)
MTLWMASPPEVHSALLSSGPGPGSVLSAAGVWSSLSAEYAAVADELIGLLGAVQTGAWQG
PSAAAYVAAHAPYLAWLMRASETSAEAAARHETVAAAYTTAVAAMPTLVELAANHTLHGV
LVATNFFGINTIPIALNEADYARMWTQAASTMATYQAVAEAAVASAPQTTPAPPILAAEA
ADDDHDHDHDHGGEPTPLDYLVAEILRIISGGRLIWDPAEGTMNGIPFEDYTDAAQPIWW
VVRAIEFSKDFETFVQELFVNPVEAFQFYFELLLFDYPTHIVQIVEALSQSPQLLAVALG
SVISNLGAVTGFAGLSGLAGMQPAAIPALAPVAAAPSTLPAVAMAPTMAAPGAAVASAAA
PASAPAASTVASATPAPPPAPGAAGFGYPYAIAPPGIGFGSGMSASASAQRKAPQPDSAA
AAAAAAAVRDQARARRRRRVTRRGYGDEFMDMNIDVDPDWGPPPGEDPVTSTVASDRGAG
HLGFAGTARREAVADAAGMTTLAGDDFGDGPTTPMVPGSWDPDRDAPGSAEPGDRG