Protein Info for Rv0262c in Mycobacterium tuberculosis H37Rv

Annotation: Aminoglycoside 2'-N-acetyltransferase Aac (Aac(2')-IC)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF13527: Acetyltransf_9" amino acids 18 to 131 (114 residues), 38.4 bits, see alignment E=1.8e-13 PF00583: Acetyltransf_1" amino acids 38 to 131 (94 residues), 38.9 bits, see alignment E=1.4e-13 PF13673: Acetyltransf_10" amino acids 45 to 132 (88 residues), 23.8 bits, see alignment E=6e-09

Best Hits

Swiss-Prot: 99% identical to AAC2_MYCBO: Aminoglycoside 2'-N-acetyltransferase (aac) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 99% identity to mbb:BCG_0300c)

Predicted SEED Role

"Aminoglycoside 2'-N-acetyltransferase AAC (AAC(2')-IC)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>Rv0262c Aminoglycoside 2'-N-acetyltransferase Aac (Aac(2')-IC) (Mycobacterium tuberculosis H37Rv)
VHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIA
HAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSA
RARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDV
W