Protein Info for Rv0246 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 139 (26 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 294 to 317 (24 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb0252)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>Rv0246 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
VAKTSHRVSSADGMSKRILRLIIAQSGFYSAALQLGNVSIVLPFVVAELDAELWIAALIF
PAFTAGGAIGNVVAPPAVAAVPRRHRLFIIVSCLAVLAGVNALCATIGKGSVAGILLVVN
VTLIGVVSAISFVAFADLVAAMPSGTARARILLTEVGVGAALTAVVAATLSFVPDQHPLS
RNIHLLWTAAVAMAISAAICRALPHRIVPRVHAAPGLHKLVYVGWTAIRTNGWYRRYLLV
QVLFGSVVLGSSFHSIRVAAVPGDQPDEVVAVVLFVCVGLLGGIALWNRVRERFGLVGLF
VGSALVSIAAAVLSIAFDLAGAWPNVVAIGLVIALVSIANQSVFTAGQLWIARDAEPGLR
TSLISFGQLVINAGLVGMGLALGLIAQDHDAVWPVMIVLLLNLTAAYSATRFAPAKSVDV
RGLPQVSRTSRPKTGG