Protein Info for Rv0233 in Mycobacterium tuberculosis H37Rv

Annotation: Ribonucleoside-diphosphate reductase (beta chain) NrdB (ribonucleotide reductase small chain)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF00268: Ribonuc_red_sm" amino acids 28 to 273 (246 residues), 71.2 bits, see alignment E=4.8e-24

Best Hits

Swiss-Prot: 100% identical to RIR2H_MYCTA: R2-like ligand binding oxidase (MRA_0241) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 100% identity to mtf:TBFG_10235)

Predicted SEED Role

"NrdB"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>Rv0233 Ribonucleoside-diphosphate reductase (beta chain) NrdB (ribonucleotide reductase small chain) (Mycobacterium tuberculosis H37Rv)
MTRTRSGSLAAGGLNWASLPLKLFAGGNAKFWHPADIDFTRDRADWEKLSDDERDYATRL
CTQFIAGEEAVTEDIQPFMSAMRAEGRLADEMYLTQFAFEEAKHTQVFRMWLDAVGISED
LHRYLDDLPAYRQIFYAELPECLNALSADPSPAAQVRASVTYNHIVEGMLALTGYYAWHK
ICVERAILPGMQELVRRIGDDERRHMAWGTFTCRRHVAADDANWTVFETRMNELIPLALR
LIEEGFALYGDQPPFDLSKDDFLQYSTDKGMRRFGTISNARGRPVAEIDVDYSPAQLEDT
FADEDRRTLAAASA