Protein Info for Rv0230c in Mycobacterium tuberculosis H37Rv

Annotation: Probable phosphotriesterase Php (parathion hydrolase) (PTE) (aryldialkylphosphatase) (paraoxonase) (a-esterase) (aryltriphosphatase) (paraoxon hydrolase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF02126: PTE" amino acids 11 to 320 (310 residues), 493.3 bits, see alignment E=1.5e-152

Best Hits

Swiss-Prot: 100% identical to PHP_MYCTU: Phosphotriesterase homology protein (php) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07048, phosphotriesterase-related protein (inferred from 99% identity to mbb:BCG_0267c)

Predicted SEED Role

"parathion hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>Rv0230c Probable phosphotriesterase Php (parathion hydrolase) (PTE) (aryldialkylphosphatase) (paraoxonase) (a-esterase) (aryltriphosphatase) (paraoxon hydrolase) (Mycobacterium tuberculosis H37Rv)
VPELNTARGPIDTADLGVTLMHEHVFIMTTEIAQNYPEAWGDEDKRVAGAIARLGELKAR
GVDTIVDLTVIGLGRYIPRIARVAAATELNIVVATGLYTYNDVPFYFHYLGPGAQLDGPE
IMTDMFVRDIEHGIADTGIKAGILKCATDEPGLTPGVERVLRAVAQAHKRTGAPISTHTH
AGLRRGLDQQRIFAEEGVDLSRVVIGHCGDSTDVGYLEELIAAGSYLGMDRFGVDVISPF
QDRVNIVARMCERGHADKMVLSHDACCYFDALPEELVPVAMPNWHYLHIHNDVIPALKQH
GVTDEQLHTMLVDNPRRIFERQGGYQ