Protein Info for Rv0228 in Mycobacterium tuberculosis H37Rv

Annotation: Probable integral membrane acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 70 to 92 (23 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 327 to 351 (25 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 38 to 370 (333 residues), 101.6 bits, see alignment E=2.3e-33

Best Hits

KEGG orthology group: K00680, [EC: 2.3.1.-] (inferred from 100% identity to mtu:Rv0228)

Predicted SEED Role

"Lysophospholipid acyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>Rv0228 Probable integral membrane acyltransferase (Mycobacterium tuberculosis H37Rv)
MGPADESGAPIRPQTPHRHTVLVTNGQVVGGTRGFLPAVEGMRACAAVGVVVTHVAFQTG
HSSGVGGRLFGRFDLAVAVFFAVSGFLLWRGHAAAARDLRSHPRTGPYLRSRVARIMPAY
VVAVVVILSLLPDADHASLTVWLANLTLTQIYVPLTLTGGLTQMWSLSVEVAFYAALPVL
ALLGRRIPVGARVPAIAALAALSWAWGWLPLDAGSGINPLTWPPAFFSWFAAGMLLAEWA
YSPVGLPHRWARRRVAMAVTALLGYLVAASPLAGPEGLVPGTAAQFAVKTAMGSLVAFAL
VAPLVLDRPDTSHRLLGSPAMVTLGRWSYGLFIWHLAALAMVFPVIGAFPFTGRMPTVLV
LTLIFGFAIAAVSYALVESPCREALRRWERRNEPISVGELQADAIAP