Protein Info for Rv0225 in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 21 to 186 (166 residues), 63.3 bits, E=9e-21
• PF13579: Glyco_trans_4_4
  • amino acids 21 to 183 (163 residues), 59.6 bits, E=1.5e-19
• PF20706: GT4-conflict
  • amino acids 174 to 318 (145 residues), 41.8 bits, E=2.1e-14
• PF00534: Glycos_transf_1
  • amino acids 200 to 353 (154 residues), 107.9 bits, E=1.2e-34
• PF13692: Glyco_trans_1_4
  • amino acids 200 to 340 (141 residues), 79.1 bits, E=1.3e-25
• PF13524: Glyco_trans_1_2
  • amino acids 279 to 367 (89 residues), 37.2 bits, E=8.3e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00226)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Protein Sequence (384 amino acids)

>Rv0225 Possible conserved protein (Mycobacterium tuberculosis H37Rv)
MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRTARYPGAPRHELVDGV
RISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGWPFVARLLYGRRSLVLV
HHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPSARDLIALGVDSERIAVV
RNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVAELQPRIPGLHLDIVGGGW
WRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLLPSRKEGWGLAVIEAAQHGV
PTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSDSVLRDQLGAKAQARSGEFSW
RQSAEALRSVLEAVQASRFVSGVV