Protein Info for Rv0225 in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 70 to 89 (20 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 21 to 186 (166 residues), 62.7 bits, see alignment E=1.3e-20 PF13579: Glyco_trans_4_4" amino acids 21 to 183 (163 residues), 53.3 bits, see alignment E=1.3e-17 PF20706: GT4-conflict" amino acids 175 to 317 (143 residues), 41.6 bits, see alignment E=2.4e-14 PF00534: Glycos_transf_1" amino acids 200 to 353 (154 residues), 107.9 bits, see alignment E=1.2e-34 PF13692: Glyco_trans_1_4" amino acids 200 to 340 (141 residues), 84.1 bits, see alignment E=3.5e-27 PF13524: Glyco_trans_1_2" amino acids 221 to 367 (147 residues), 32.4 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00226)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>Rv0225 Possible conserved protein (Mycobacterium tuberculosis H37Rv)
MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRTARYPGAPRHELVDGV
RISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGWPFVARLLYGRRSLVLV
HHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPSARDLIALGVDSERIAVV
RNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVAELQPRIPGLHLDIVGGGW
WRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLLPSRKEGWGLAVIEAAQHGV
PTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSDSVLRDQLGAKAQARSGEFSW
RQSAEALRSVLEAVQASRFVSGVV