Protein Info for Rv0224c in Mycobacterium tuberculosis H37Rv

Annotation: Possible methyltransferase (methylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 230 to 252 (23 residues), see Phobius details PF13489: Methyltransf_23" amino acids 55 to 159 (105 residues), 38.1 bits, see alignment E=3.8e-13 PF08242: Methyltransf_12" amino acids 63 to 153 (91 residues), 31.2 bits, see alignment E=9.3e-11 PF13649: Methyltransf_25" amino acids 63 to 152 (90 residues), 43.4 bits, see alignment E=1.4e-14 PF08241: Methyltransf_11" amino acids 63 to 155 (93 residues), 64.8 bits, see alignment E=2.7e-21

Best Hits

Swiss-Prot: 100% identical to Y232_MYCTA: Uncharacterized methyltransferase MRA_0232 (MRA_0232) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 99% identity to mbb:BCG_0261c)

Predicted SEED Role

"POSSIBLE METHYLTRANSFERASE (METHYLASE)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>Rv0224c Possible methyltransferase (methylase) (Mycobacterium tuberculosis H37Rv)
VAVTDVFARRATLRRSLRLLADFRYEQRDPARFYRTLAADTAAMIGDLWLATHSEPPVGR
TLLDVGGGPGYFATAFSDAGVGYIGVEPDPDEMHAAGPAFTGRPGMFVRASGMALPFADD
SVDICLSSNVAEHVPRPWQLGTEMLRVTKPGGLVVLSYTVWLGPFGGHEMGLSHYLGGAR
AAARYVRKHGHPAKNNYGSSLFAVSAAEGLRWAAGTGAALAVFPRYHPRWAWWLTSVPVL
REFLVSNLVLVLTP