Protein Info for Rv0215c in Mycobacterium tuberculosis H37Rv

Annotation: Probable acyl-CoA dehydrogenase FadE3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 7 to 117 (111 residues), 105.2 bits, E=5.2e-34
• PF02770: Acyl-CoA_dh_M
  • amino acids 122 to 220 (99 residues), 90.2 bits, E=1.6e-29
• PF00441: Acyl-CoA_dh_1
  • amino acids 234 to 356 (123 residues), 129.4 bits, E=2.7e-41
• PF08028: Acyl-CoA_dh_2
  • amino acids 251 to 357 (107 residues), 64.2 bits, E=3.1e-21

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to mbo:Mb0221c)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (17/27 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.99.- or 1.3.99.2

Protein Sequence (357 amino acids)

>Rv0215c Probable acyl-CoA dehydrogenase FadE3 (Mycobacterium tuberculosis H37Rv)
VRNELNDDEAMLVATVRAFIDRDVKPTVREVEHANSYPEAWIEQMKHIGIYGLAIDEQYG
GSPVSMPCYVQVTQELARGWMSLAGAMGGHTVVAKLLTLFGTEEQRRTYLPPMASGELRA
TMALTEPGGGSDLQNMSTTALADGPEGSAGLLINGCKTWISNARRSGLFAVLCKTDPNAT
PRHQGMSIVLVEPGPGLTVSRDLPKLGYKGVESCELSFDNLRVPVSAILGGAMGQGFSQM
MKGLETGRIQVAARALGVATAALEDSLAYAQQRESFGRPIWQHQAVGNYLADMATKLTAA
RQLTRYAAERYDSGQRCDMEAGMAKLFASEVAMEIALNAVRIHGGYGYSTEYDVERR