Protein Info for Rv0214 in Mycobacterium tuberculosis H37Rv

Annotation: Probable fatty-acid-CoA ligase FadD4 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 PF00501: AMP-binding" amino acids 42 to 389 (348 residues), 222.5 bits, see alignment E=8e-70 PF13193: AMP-binding_C" amino acids 447 to 525 (79 residues), 63.8 bits, see alignment E=2.3e-21

Best Hits

KEGG orthology group: K01897, long-chain acyl-CoA synthetase [EC: 6.2.1.3] (inferred from 100% identity to mtc:MT0224)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.3

Use Curated BLAST to search for 6.2.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>Rv0214 Probable fatty-acid-CoA ligase FadD4 (fatty-acid-CoA synthetase) (fatty-acid-CoA synthase) (Mycobacterium tuberculosis H37Rv)
LPRGELYKRFRLVMGGIAPCGSGRRAATYPRRMQIRPYIGADKPAVILYPSGTVISFDEL
EARANRLAHWFRQAGLREDDVVAILMENNEHVHAVMWAARRSGLYYVPINTHLTASEAAY
IVDNSGAKAIVGSAALRETCHGLAEHLPGGLPDLLMLAGGGLVGWMTYPECVADQPDTPI
EDEREGDLLQYSSGTTGRPKGIKRELPHVSPDAAPGMMPALLDFWMDADSVYLSPAPMYH
TAPSVWTMSALAAGVTTVVMEKFDAEGALDAIQRYRVTHAQFVPAMFVRMLKLPEAVRNS
YDMSSLRRVIHAAAPCPVQIKEQMIHWWGPIIDEYYASSEASGSTLITAEDWLTHPGSVG
KPIQGGVHIVGADGSELPPNQPGEIYFEGGYPFEYLNDPAKTAASRNKHGWVTVGDVGYL
DDDGYLFLTGRRHHMIISGGVNIYPQEAENLLVAHPKVLDAAVFGVPDDEMGQRVMAAVQ
TVDSADANDQFAGELLAWLRDRLSHFKCPRSIAFEPQLPRTDTGKLYKSGLVEKYSV