Protein Info for Rv0203 in Mycobacterium tuberculosis H37Rv

Annotation: Possible exported protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR04530: hemophore" amino acids 16 to 133 (118 residues), 201.3 bits, see alignment E=3.9e-64 PF16525: MHB" amino acids 39 to 115 (77 residues), 96.5 bits, see alignment E=4.3e-32 TIGR04529: hemophore-related protein, Rv0203/Rv1174c family" amino acids 41 to 117 (77 residues), 81.1 bits, see alignment E=8.4e-27

Best Hits

Swiss-Prot: 100% identical to RV203_MYCTU: Heme-binding protein Rv0203 (Rv0203) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 99% identity to mbt:JTY_0209)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (136 amino acids)

>Rv0203 Possible exported protein (Mycobacterium tuberculosis H37Rv)
MKTGTATTRRRLLAVLIALALPGAAVALLAEPSATGASDPCAASEVARTVGSVAKSMGDY
LDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVASDLHALSQPLTDLSTRCSLPIS
GLQAIGLMQAVQGARR