Protein Info for Rv0195 in Mycobacterium tuberculosis H37Rv

Annotation: Possible two component transcriptional regulatory protein (probably LuxR-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00196: GerE" amino acids 150 to 205 (56 residues), 46.8 bits, see alignment E=8.9e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00196)

Predicted SEED Role

"Transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>Rv0195 Possible two component transcriptional regulatory protein (probably LuxR-family) (Mycobacterium tuberculosis H37Rv)
MAPVNVISVAVVASDPLTRDGALARLSSHRELDVRAWQAGCETSVLLVLATTITAPLLCQ
IEDVQKDGPSHAPKLVVVADEFSAEQVFRMIKLGLTGLLYRSQSTFDCIVETIRLSAEGR
LRLPERVQRYLVGRIKSTPTAEPDTPCAAALAEREVAVLRLLADGLSTHQVAVQLNYCER
TIKNIVHDIVTRLKLRNRTHAVAHALRAGLI