Protein Info for Rv0191 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 138 (26 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 221 to 245 (25 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 367 (342 residues), 122.7 bits, see alignment E=8.5e-40

Best Hits

Swiss-Prot: 100% identical to Y191_MYCTU: Uncharacterized MFS-type transporter Rv0191 (Rv0191) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT0201)

Predicted SEED Role

"Integral membrane protein, sugar transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>Rv0191 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MTAPTGTSATTTRPWTPRIATQLSVLACAAFIYVTAEILPVGALSAIARNLRVSVVLVGT
LLSWYALVAAVTTVPLVRWTAHWPRRRALVVSLVCLTVSQLVSALAPNFAVLAAGRVLCA
VTHGLLWAVIAPIATRLVPPSHAGRATTSIYIGTSLALVVGSPLTAAMSLMWGWRLAAVC
VTGAAAAVALAARLALPEMVLRADQLEHVGRRARHHRNPRLVKVSVLTMIAVTGHFVSYT
YIVVIIRDVVGVRGPNLAWLLAAYGVAGLVSVPLVARPLDRWPKGAVIVGMTGLTAAFTL
LTALAFGERHTAATALLGTGAIVLWGALATAVSPMLQSAAMRSGGDDPDGASGLYVTAFQ
IGIMAGALLGGLLYERSLAMMLTASAGLMGVALFGMTVSQHLFENPTLSPGDG