Protein Info for Rv0180c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 34 to 407 (374 residues), 63 bits, see alignment E=2.8e-21 PF12051: DUF3533" amino acids 36 to 381 (346 residues), 87.3 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_10181)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>Rv0180c Probable conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MSQAQPRPAAPNPKRNVKAIRTVRFWMAPIATTLALMSALAALYLGGILNPMTNLRHFPI
ALVNEDAGPAGQQIVDGLVSGLDKNKFDIRVVSPDEARRLLDTAAVYGSALIPPTFSSQL
RDFGASAVTPTRTDRPAITISTNPRAGTLAASIAGQTLTRALTVVNGKVGERLTAEVAAQ
TGGVALAGAAAAGLASPIDVKSTAYNPLPNGTGNGLSAFYYALLLLLAGFTGSIVVSTLV
DSMLGYVPAEFGPVYRFAEQVNISRFRTLLVKWAVMVVLALLTSGVYLAIAHGLGMPIPL
GWQVWLYGVFAIIAVGVTSSSLIAVLGSMGLLVSMLIFVILGLPSAGATVPLEAVPAFFR
WLAQFEPMHQVFLGVRSLLYLNGNADAGLSQALTMTSIGLIIGLLLGGFITHLYDRSSFH
RIPGAVEMAIAVEHQAQYQARQSARESSSEQP