Protein Info for Rv0174 in Mycobacterium tuberculosis H37Rv

Annotation: Mce-family protein Mce1F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 10 to 29 (20 residues), see Phobius details TIGR00996: virulence factor Mce family protein" amino acids 9 to 294 (286 residues), 298.9 bits, see alignment E=1.8e-93 PF02470: MlaD" amino acids 39 to 112 (74 residues), 64.1 bits, see alignment E=1.2e-21 PF11887: Mce4_CUP1" amino acids 122 to 286 (165 residues), 37.7 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 100% identity to mbb:BCG_0211)

Predicted SEED Role

"MCE family protein of Mce F Subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>Rv0174 Mce-family protein Mce1F (Mycobacterium tuberculosis H37Rv)
VLTRFIRRQLILFAIVSVVAIVVLGWYYLRIPSLVGIGQYTLKADLPASGGLYPTANVTY
RGITIGKVTAVEPTDQGARVTMSIASNYKIPVDASANVHSVSAVGEQYIDLVSTGAPGKY
FSSGQTITKGTVPSEIGPALDNSNRGLAALPTEKIGLLLDETAQAVGGLGPALQRLVDST
QAIVGDFKTNIGDVNDIIENSGPILDSQVNTGDQIERWARKLNNLAAQTATRDQNVRSIL
SQAAPTADEVNAVFSGVRDSLPQTLANLEVVFDMLKRYHAGVEQLLVFLPQGAAIAQTVL
TPTPGAAQLPLAPAINYPPPCLTGFLPASEWRSPADTSPRPLPSGTYCKIPQDAQLQVRG
ARNIPCVDVLGKRAATPKECRSKDPYVPLGTNPWFGDPNQILTCPAPGARCDQPVKPGLV
IPAPSINTGLNPAPADQVQGTPPPVSDPLQRPGSGTVQCNGQQPNPCVYTPTSGPSAVYS
PASGELVGPDGVKYAVANSSTTGDDGWKEMLAPAS